PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa004653
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family Dof
Protein Properties Length: 303aa    MW: 33787.9 Da    PI: 7.2743
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-27626PU_refplantGDBView CDS
gnl|UG|Lsa#S32121423PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.4e-392888262
     zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
               +++ lkcprCds+ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg rk k+ss
  Lsa004653 28 HHQDLKCPRCDSSNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGIRKAKRSS 88
               56889****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-242880IPR003851Zinc finger, Dof-type
PfamPF027012.1E-333086IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1893286IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103470IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MQDIHSFESS GGGDALFAGG GDRRYRHHHQ DLKCPRCDSS NTKFCYYNNY NLSQPRHFCK  60
SCRRYWTKGG VLRNVPVGGG IRKAKRSSKP KSRISIPCSD AVAAERKSSN SENSSSESST  120
PNRTATTTTS ITTTDASGSN STNSTPAMML NFNESSRRFF NIPQSSTLIT TFDPIMVNNP  180
SAGNKSSEIG AFTNMMTSST DQLSDIPSFQ LQQKNTEDVV GNHNCNQIQW TVETMGFMDQ  240
AADIELSIYG SRRNNGGIAG IENWQHSTDE SLFDLTGNLD QSYWNQNHWK DDDHNQYHLN  300
YIP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A103XX216e-78A0A103XX21_CYNCS; Zinc finger, Dof-type
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.16e-32OBF binding protein 4